SCOP 1.63: Domain d1ftxb1: 1ftx B:2-11,B:245-381

Lineage for d1ftxb1 (1ftx B:2-11,B:245-381)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.2: Alanine racemase-like, C-terminal domain [50621] (1 family)
   the barrel is decorated with additional structures

5. Family b.49.2.1: Alanine racemase-like, C-terminal domain [50622] (2 proteins)

6. Protein Alanine racemase [50623] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [50624] (7 PDB entries)

8. Domain d1ftxb1: 1ftx B:2-11,B:245-381 [76193]
   Other proteins in same PDB: d1ftxa2, d1ftxb2
   complexed with in5, kcx

Details for d1ftxb1

PDB Entry: 1ftx, 2.2 Å

PDB Description: crystal structure of alanine racemase in complex with d-alanine phosphonate

SCOP Domain Sequences for d1ftxb1:

Sequence; same for both SEQRES and ATOM records:

>d1ftxb1 b.49.2.1 (B:2-11,B:245-381) Alanine racemase {Bacillus stearothermophilus}
ndfhrdtwaeXfslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlq
hfhvlvdgqkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletin
yevpctisyrvpriffrhkrimevrnai

Timeline for d1ftxb1:

• d1ftxb1 is new in SCOP 1.63
  
• d1ftxb1 appears in SCOP 1.65
  
• d1ftxb1 appears in the current release, SCOPe 2.08