SCOP 1.65: Domain d1ftxa2: 1ftx A:12-244

Lineage for d1ftxa2 (1ftx A:12-244)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.6: PLP-binding barrel [51419] (2 families)
   circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand

5. Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (3 proteins)

6. Protein Alanine racemase [51421] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [51422] (7 PDB entries)

8. Domain d1ftxa2: 1ftx A:12-244 [76192]
   Other proteins in same PDB: d1ftxa1, d1ftxb1

Details for d1ftxa2

PDB Entry: 1ftx, 2.2 Å

PDB Description: crystal structure of alanine racemase in complex with d-alanine phosphonate

SCOP Domain Sequences for d1ftxa2:

Sequence; same for both SEQRES and ATOM records:

>d1ftxa2 c.1.6.1 (A:12-244) Alanine racemase {Bacillus stearothermophilus}
vdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasrlavafldeal
alrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgpfpihfhlkmd
tgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyqytrflhmlew
lpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpyplkea

Timeline for d1ftxa2:

• d1ftxa2 first appeared in SCOP 1.63
  
• d1ftxa2 appears in SCOP 1.67
  
• d1ftxa2 appears in the current release, SCOPe 2.08