| Class b: All beta proteins [48724] (177 folds) |
| Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) ![]() the barrel is decorated with additional structures |
| Family b.49.2.2: Alanine racemase-like, C-terminal domain [88682] (2 proteins) |
| Protein Alanine racemase [50623] (3 species) |
| Species Bacillus stearothermophilus [TaxId:1422] [50624] (8 PDB entries) |
| Domain d1ftxa1: 1ftx A:2-11,A:245-381 [76191] Other proteins in same PDB: d1ftxa2, d1ftxb2 complexed with epc |
PDB Entry: 1ftx (more details), 2.2 Å
SCOPe Domain Sequences for d1ftxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ftxa1 b.49.2.2 (A:2-11,A:245-381) Alanine racemase {Bacillus stearothermophilus [TaxId: 1422]}
ndfhrdtwaeXfslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlq
hfhvlvdgqkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletin
yevpctisyrvpriffrhkrimevrnai
Timeline for d1ftxa1: