Lineage for d1ftxa1 (1ftx A:2-11,A:245-381)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 231263Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 231333Superfamily b.49.2: Alanine racemase-like, C-terminal domain [50621] (1 family) (S)
    the barrel is decorated with additional structures
  5. 231334Family b.49.2.1: Alanine racemase-like, C-terminal domain [50622] (2 proteins)
  6. 231335Protein Alanine racemase [50623] (1 species)
  7. 231336Species Bacillus stearothermophilus [TaxId:1422] [50624] (7 PDB entries)
  8. 231347Domain d1ftxa1: 1ftx A:2-11,A:245-381 [76191]
    Other proteins in same PDB: d1ftxa2, d1ftxb2

Details for d1ftxa1

PDB Entry: 1ftx (more details), 2.2 Å

PDB Description: crystal structure of alanine racemase in complex with d-alanine phosphonate

SCOP Domain Sequences for d1ftxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ftxa1 b.49.2.1 (A:2-11,A:245-381) Alanine racemase {Bacillus stearothermophilus}
ndfhrdtwaeXfslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlq
hfhvlvdgqkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletin
yevpctisyrvpriffrhkrimevrnai

SCOP Domain Coordinates for d1ftxa1:

Click to download the PDB-style file with coordinates for d1ftxa1.
(The format of our PDB-style files is described here.)

Timeline for d1ftxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ftxa2