Lineage for d1ffqa2 (1ffq A:133-443,A:517-563)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 571086Superfamily c.1.8: (Trans)glycosidases [51445] (13 families) (S)
  5. 571962Family c.1.8.5: Type II chitinase [51534] (14 proteins)
    glycosylase family 18
  6. 571981Protein Chitinase A, catalytic domain [51544] (1 species)
  7. 571982Species Serratia marcescens [TaxId:615] [51545] (9 PDB entries)
  8. 571988Domain d1ffqa2: 1ffq A:133-443,A:517-563 [76184]
    Other proteins in same PDB: d1ffqa1, d1ffqa3
    complexed with ami, naa

Details for d1ffqa2

PDB Entry: 1ffq (more details), 1.9 Å

PDB Description: crystal structure of chitinase a complexed with allosamidin

SCOP Domain Sequences for d1ffqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens}
tdgshlaplkeplleknkpykqnsgkvvgsyfvewgvygrnftvdkipaqnlthllygfi
picggngindslkeiegsfqalqrscqgredfkvsihdpfaalqkaqkgvtawddpykgn
fgqlmalkqahpdlkilpsiggwtlsdpfffmgdkvkrdrfvgsvkeflqtwkffdgvdi
dwefpggkganpnlgspqdgetyvllmkelramldqlsvetgrkyeltsaisagkdkidk
vaynvaqnsmdhiflmsydfygafdlknlghqtalnapawkpdtayttvngvnallaqgv
kpgkivvgtamXdarsvqakgkyvldkqlgglfsweidadngdilnsmnaslgnsagvq

SCOP Domain Coordinates for d1ffqa2:

Click to download the PDB-style file with coordinates for d1ffqa2.
(The format of our PDB-style files is described here.)

Timeline for d1ffqa2: