Lineage for d1ffqa1 (1ffq A:24-132)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 937486Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 937592Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 937624Protein Chitinase A, N-terminal domain N [49233] (1 species)
    precedes the catalytic (beta/alpha)8-barrel domain
  7. 937625Species Serratia marcescens [TaxId:615] [49234] (11 PDB entries)
    Uniprot P07254 24-563
  8. 937631Domain d1ffqa1: 1ffq A:24-132 [76183]
    Other proteins in same PDB: d1ffqa2, d1ffqa3
    complexed with ami

Details for d1ffqa1

PDB Entry: 1ffq (more details), 1.9 Å

PDB Description: crystal structure of chitinase a complexed with allosamidin
PDB Compounds: (A:) chitinase a

SCOPe Domain Sequences for d1ffqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffqa1 b.1.18.2 (A:24-132) Chitinase A, N-terminal domain N {Serratia marcescens [TaxId: 615]}
aapgkptiawgntkfaivevdqaataynnlvkvknaadvsvswnlwngdtgttakvllng
keawsgpstgssgtanfkvnkggryqmqvalcnadgctasdateivvad

SCOPe Domain Coordinates for d1ffqa1:

Click to download the PDB-style file with coordinates for d1ffqa1.
(The format of our PDB-style files is described here.)

Timeline for d1ffqa1: