SCOP 1.73: Domain d1ffqa1: 1ffq A:24-132

Lineage for d1ffqa1 (1ffq A:24-132)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (20 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (19 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Chitinase A, N-terminal domain N [49233] (1 species)
   precedes the catalytic (beta/alpha)8-barrel domain

7. Species Serratia marcescens [TaxId:615] [49234] (11 PDB entries)

8. Domain d1ffqa1: 1ffq A:24-132 [76183]
   Other proteins in same PDB: d1ffqa2, d1ffqa3
   complexed with ami, naa

Details for d1ffqa1

PDB Entry: 1ffq, 1.9 Å

PDB Description: crystal structure of chitinase a complexed with allosamidin

PDB Compounds: (A:) chitinase a

SCOP Domain Sequences for d1ffqa1:

Sequence; same for both SEQRES and ATOM records:

>d1ffqa1 b.1.18.2 (A:24-132) Chitinase A, N-terminal domain N {Serratia marcescens [TaxId: 615]}
aapgkptiawgntkfaivevdqaataynnlvkvknaadvsvswnlwngdtgttakvllng
keawsgpstgssgtanfkvnkggryqmqvalcnadgctasdateivvad

Timeline for d1ffqa1:

• d1ffqa1 first appeared in SCOP 1.63
  
• d1ffqa1 appears in SCOP 1.71
  
• d1ffqa1 appears in SCOP 1.75
  
• d1ffqa1 appears in the current release, SCOPe 2.08