![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (20 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (19 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
![]() | Protein Chitinase A, N-terminal domain N [49233] (1 species) precedes the catalytic (beta/alpha)8-barrel domain |
![]() | Species Serratia marcescens [TaxId:615] [49234] (11 PDB entries) |
![]() | Domain d1ffqa1: 1ffq A:24-132 [76183] Other proteins in same PDB: d1ffqa2, d1ffqa3 complexed with ami, naa |
PDB Entry: 1ffq (more details), 1.9 Å
SCOP Domain Sequences for d1ffqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ffqa1 b.1.18.2 (A:24-132) Chitinase A, N-terminal domain N {Serratia marcescens [TaxId: 615]} aapgkptiawgntkfaivevdqaataynnlvkvknaadvsvswnlwngdtgttakvllng keawsgpstgssgtanfkvnkggryqmqvalcnadgctasdateivvad
Timeline for d1ffqa1: