SCOPe 2.03: Domain d1ffpd2: 1ffp D:2-181

Lineage for d1ffpd2 (1ffp D:2-181)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)

7. Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (25 PDB entries)

8. Domain d1ffpd2: 1ffp D:2-181 [76181]
   Other proteins in same PDB: d1ffpa1, d1ffpb_, d1ffpd1, d1ffpe_

Details for d1ffpd2

PDB Entry: 1ffp, 2.6 Å

PDB Description: crystal structure of murine class i h-2db complexed with peptide gp33 (c9m/k1s)

PDB Compounds: (D:) h-2 class I histocompatibility antigen, d-b, alpha chain

SCOPe Domain Sequences for d1ffpd2:

Sequence; same for both SEQRES and ATOM records:

>d1ffpd2 d.19.1.1 (D:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr

Timeline for d1ffpd2:

• d1ffpd2 first appeared in SCOP 1.63
  
• d1ffpd2 appears in SCOPe 2.02
  
• d1ffpd2 appears in SCOPe 2.04
  
• d1ffpd2 appears in the current release, SCOPe 2.08