Lineage for d1ffpd2 (1ffp D:2-181)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719351Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 719352Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 719353Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 719393Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)
  7. 719589Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (18 PDB entries)
  8. 719613Domain d1ffpd2: 1ffp D:2-181 [76181]
    Other proteins in same PDB: d1ffpa1, d1ffpb_, d1ffpd1, d1ffpe_
    mutant

Details for d1ffpd2

PDB Entry: 1ffp (more details), 2.6 Å

PDB Description: crystal structure of murine class i h-2db complexed with peptide gp33 (c9m/k1s)
PDB Compounds: (D:) h-2 class I histocompatibility antigen, d-b, alpha chain

SCOP Domain Sequences for d1ffpd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffpd2 d.19.1.1 (D:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr

SCOP Domain Coordinates for d1ffpd2:

Click to download the PDB-style file with coordinates for d1ffpd2.
(The format of our PDB-style files is described here.)

Timeline for d1ffpd2: