SCOPe 2.06: Domain d1ffpd1: 1ffp D:182-274

Lineage for d1ffpd1 (1ffp D:182-274)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Class I MHC, alpha-3 domain [88604] (4 species)
Species Mouse (Mus musculus) [TaxId:10090] [88606] (109 PDB entries)
Uniprot P01901 22-299
Domain d1ffpd1: 1ffp D:182-274 [76180]
Other proteins in same PDB: d1ffpa2, d1ffpb1, d1ffpb2, d1ffpd2, d1ffpe1, d1ffpe2

Details for d1ffpd1

PDB Entry: 1ffp (more details), 2.6 Å

PDB Description: crystal structure of murine class i h-2db complexed with peptide gp33 (c9m/k1s)

PDB Compounds: (D:) h-2 class I histocompatibility antigen, d-b, alpha chain

SCOPe Domain Sequences for d1ffpd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffpd1 b.1.1.2 (D:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrw

SCOPe Domain Coordinates for d1ffpd1:

Click to download the PDB-style file with coordinates for d1ffpd1.
(The format of our PDB-style files is described here.)

Timeline for d1ffpd1: