SCOP 1.63: Domain d1ffpa2: 1ffp A:2-181

Lineage for d1ffpa2 (1ffp A:2-181)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)

6. Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species)

7. Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (13 PDB entries)

8. Domain d1ffpa2: 1ffp A:2-181 [76178]
   Other proteins in same PDB: d1ffpa1, d1ffpb_, d1ffpd1, d1ffpe_

Details for d1ffpa2

PDB Entry: 1ffp, 2.6 Å

PDB Description: crystal structure of murine class i h-2db complexed with peptide gp33 (c9m/k1s)

SCOP Domain Sequences for d1ffpa2:

Sequence; same for both SEQRES and ATOM records:

>d1ffpa2 d.19.1.1 (A:2-181) MHC class I, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB}
phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr

Timeline for d1ffpa2:

• d1ffpa2 is new in SCOP 1.63
  
• d1ffpa2 appears in SCOP 1.65
  
• d1ffpa2 appears in the current release, SCOPe 2.08