Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein beta2-microglobulin [88600] (4 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88603] (85 PDB entries) |
Domain d1ffoe_: 1ffo E: [76176] Other proteins in same PDB: d1ffoa1, d1ffoa2, d1ffod1, d1ffod2 mutant |
PDB Entry: 1ffo (more details), 2.65 Å
SCOP Domain Sequences for d1ffoe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ffoe_ b.1.1.2 (E:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d1ffoe_: