Lineage for d1ffob_ (1ffo B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 931882Protein beta2-microglobulin [88600] (5 species)
  7. 932374Species Mouse (Mus musculus) [TaxId:10090] [88603] (142 PDB entries)
    Uniprot P01887
  8. 932549Domain d1ffob_: 1ffo B: [76173]
    Other proteins in same PDB: d1ffoa1, d1ffoa2, d1ffod1, d1ffod2

Details for d1ffob_

PDB Entry: 1ffo (more details), 2.65 Å

PDB Description: crystal structure of murine class i h-2db complexed with synthetic peptide gp33 (c9m/k1a)
PDB Compounds: (B:) beta-2 microglobulin beta chain

SCOPe Domain Sequences for d1ffob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffob_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1ffob_:

Click to download the PDB-style file with coordinates for d1ffob_.
(The format of our PDB-style files is described here.)

Timeline for d1ffob_: