SCOP 1.65: Domain d1ffob_: 1ffo B:

Lineage for d1ffob_ (1ffo B:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein beta2-microglobulin [88600] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (48 PDB entries)

8. Domain d1ffob_: 1ffo B: [76173]
   Other proteins in same PDB: d1ffoa1, d1ffoa2, d1ffod1, d1ffod2

Details for d1ffob_

PDB Entry: 1ffo, 2.65 Å

PDB Description: crystal structure of murine class i h-2db complexed with synthetic peptide gp33 (c9m/k1a)

SCOP Domain Sequences for d1ffob_:

Sequence; same for both SEQRES and ATOM records:

>d1ffob_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus)}
miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1ffob_:

• d1ffob_ first appeared in SCOP 1.63
  
• d1ffob_ appears in SCOP 1.67
  
• d1ffob_ appears in the current release, SCOPe 2.07, called d1ffob1