Lineage for d1ffoa2 (1ffo A:2-181)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2544723Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2545067Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (28 PDB entries)
  8. 2545122Domain d1ffoa2: 1ffo A:2-181 [76172]
    Other proteins in same PDB: d1ffoa1, d1ffob1, d1ffob2, d1ffod1, d1ffoe1, d1ffoe2

Details for d1ffoa2

PDB Entry: 1ffo (more details), 2.65 Å

PDB Description: crystal structure of murine class i h-2db complexed with synthetic peptide gp33 (c9m/k1a)
PDB Compounds: (A:) h-2 class I histocompatibility antigen, d-b, alpha chain

SCOPe Domain Sequences for d1ffoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffoa2 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr

SCOPe Domain Coordinates for d1ffoa2:

Click to download the PDB-style file with coordinates for d1ffoa2.
(The format of our PDB-style files is described here.)

Timeline for d1ffoa2: