Lineage for d1ffoa2 (1ffo A:2-181)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 326693Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 326694Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 326695Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)
  6. 326714Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (19 species)
  7. 326808Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (14 PDB entries)
  8. 326818Domain d1ffoa2: 1ffo A:2-181 [76172]
    Other proteins in same PDB: d1ffoa1, d1ffob_, d1ffod1, d1ffoe_

Details for d1ffoa2

PDB Entry: 1ffo (more details), 2.65 Å

PDB Description: crystal structure of murine class i h-2db complexed with synthetic peptide gp33 (c9m/k1a)

SCOP Domain Sequences for d1ffoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffoa2 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB}
phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr

SCOP Domain Coordinates for d1ffoa2:

Click to download the PDB-style file with coordinates for d1ffoa2.
(The format of our PDB-style files is described here.)

Timeline for d1ffoa2: