SCOP 1.73: Domain d1ffne_: 1ffn E:

Lineage for d1ffne_ (1ffn E:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein beta2-microglobulin [88600] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (85 PDB entries)

8. Domain d1ffne_: 1ffn E: [76170]
   Other proteins in same PDB: d1ffna1, d1ffna2, d1ffnd1, d1ffnd2
   mutant

Details for d1ffne_

PDB Entry: 1ffn, 2.7 Å

PDB Description: crystal structure of murine class i h-2db complexed with peptide gp33(c9m)

PDB Compounds: (E:) beta-2 microglobulin, beta chain

SCOP Domain Sequences for d1ffne_:

Sequence; same for both SEQRES and ATOM records:

>d1ffne_ b.1.1.2 (E:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1ffne_:

• d1ffne_ first appeared in SCOP 1.63
  
• d1ffne_ appears in SCOP 1.71
  
• d1ffne_ appears in SCOP 1.75
  
• d1ffne_ appears in the current release, SCOPe 2.08, called d1ffne1