Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species) |
Species Mouse (Mus musculus), H-2DB [TaxId:10090] [48960] (13 PDB entries) |
Domain d1ffne_: 1ffn E: [76170] Other proteins in same PDB: d1ffna2, d1ffnd2 mutant |
PDB Entry: 1ffn (more details), 2.7 Å
SCOP Domain Sequences for d1ffne_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ffne_ b.1.1.2 (E:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2DB} miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d1ffne_: