Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins) |
Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species) |
Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (13 PDB entries) |
Domain d1ffnd2: 1ffn D:2-181 [76169] Other proteins in same PDB: d1ffna1, d1ffnb_, d1ffnd1, d1ffne_ mutant |
PDB Entry: 1ffn (more details), 2.7 Å
SCOP Domain Sequences for d1ffnd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ffnd2 d.19.1.1 (D:2-181) MHC class I, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB} phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr
Timeline for d1ffnd2:
View in 3D Domains from other chains: (mouse over for more information) d1ffna1, d1ffna2, d1ffnb_, d1ffne_ |