Lineage for d1ffnd2 (1ffn D:2-181)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2506505Family d.19.1.1: MHC antigen-recognition domain [54453] (13 protein domains)
  6. 2506604Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
  7. 2506930Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (28 PDB entries)
  8. 2506969Domain d1ffnd2: 1ffn D:2-181 [76169]
    Other proteins in same PDB: d1ffna1, d1ffnb1, d1ffnb2, d1ffnd1, d1ffne1, d1ffne2

Details for d1ffnd2

PDB Entry: 1ffn (more details), 2.7 Å

PDB Description: crystal structure of murine class i h-2db complexed with peptide gp33(c9m)
PDB Compounds: (D:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d1ffnd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffnd2 d.19.1.1 (D:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr

SCOPe Domain Coordinates for d1ffnd2:

Click to download the PDB-style file with coordinates for d1ffnd2.
(The format of our PDB-style files is described here.)

Timeline for d1ffnd2: