SCOP 1.63: Domain d1ffnb_: 1ffn B:

Lineage for d1ffnb_ (1ffn B:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)

7. Species Mouse (Mus musculus), H-2DB [TaxId:10090] [48960] (13 PDB entries)

8. Domain d1ffnb_: 1ffn B: [76167]
   Other proteins in same PDB: d1ffna2, d1ffnd2

Details for d1ffnb_

PDB Entry: 1ffn, 2.7 Å

PDB Description: crystal structure of murine class i h-2db complexed with peptide gp33(c9m)

SCOP Domain Sequences for d1ffnb_:

Sequence; same for both SEQRES and ATOM records:

>d1ffnb_ b.1.1.2 (B:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2DB}
miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1ffnb_:

• d1ffnb_ is new in SCOP 1.63
  
• d1ffnb_ appears in SCOP 1.65
  
• d1ffnb_ appears in the current release, SCOPe 2.08, called d1ffnb1