Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (7 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries) Uniprot P01887 |
Domain d1ffnb1: 1ffn B:1-99 [76167] Other proteins in same PDB: d1ffna1, d1ffna2, d1ffnb2, d1ffnd1, d1ffnd2, d1ffne2 |
PDB Entry: 1ffn (more details), 2.7 Å
SCOPe Domain Sequences for d1ffnb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ffnb1 b.1.1.2 (B:1-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d1ffnb1: