SCOP 1.71: Domain d1ffna2: 1ffn A:2-181

Lineage for d1ffna2 (1ffn A:2-181)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)

7. Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (18 PDB entries)

8. Domain d1ffna2: 1ffn A:2-181 [76166]
   Other proteins in same PDB: d1ffna1, d1ffnb_, d1ffnd1, d1ffne_

Details for d1ffna2

PDB Entry: 1ffn, 2.7 Å

PDB Description: crystal structure of murine class i h-2db complexed with peptide gp33(c9m)

SCOP Domain Sequences for d1ffna2:

Sequence; same for both SEQRES and ATOM records:

>d1ffna2 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB}
phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr

Timeline for d1ffna2:

• d1ffna2 first appeared in SCOP 1.63
  
• d1ffna2 appears in SCOP 1.69
  
• d1ffna2 appears in SCOP 1.73
  
• d1ffna2 appears in the current release, SCOPe 2.08