Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species) |
Species Mouse (Mus musculus), H-2DB [TaxId:10090] [48960] (13 PDB entries) |
Domain d1ffna1: 1ffn A:182-274 [76165] Other proteins in same PDB: d1ffna2, d1ffnd2 |
PDB Entry: 1ffn (more details), 2.7 Å
SCOP Domain Sequences for d1ffna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ffna1 b.1.1.2 (A:182-274) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2DB} tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf qkwasvvvplgkeqnytcrvyheglpepltlrw
Timeline for d1ffna1:
View in 3D Domains from other chains: (mouse over for more information) d1ffnb_, d1ffnd1, d1ffnd2, d1ffne_ |