Lineage for d1fd0a_ (1fd0 A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 285381Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 285382Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 285383Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (25 proteins)
  6. 285530Protein Retinoic acid receptor gamma (RAR-gamma) [48515] (1 species)
  7. 285531Species Human (Homo sapiens) [TaxId:9606] [48516] (9 PDB entries)
  8. 285534Domain d1fd0a_: 1fd0 A: [76164]
    complexed with 254, lmu

Details for d1fd0a_

PDB Entry: 1fd0 (more details), 1.38 Å

PDB Description: isotype selectivity of the human retinoic acid nuclear receptor hrar: the complex with the rargamma-selective retinoid sr11254

SCOP Domain Sequences for d1fd0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fd0a_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens)}
spqleelitkvskahqetfpslcqlgkyttnssadhrvqldlglwdkfselatkciikiv
efakrlpgftglsiadqitllkaacldilmlrictrytpeqdtmtfsdgltlnrtqmhna
gfgpltdlvfafagqllplemddtetgllsaiclicgdrmdleepekvdklqepllealr
lyarrrrpsqpymfprmlmkitdlrgistkgaeraitlkmeipgpmppliremle

SCOP Domain Coordinates for d1fd0a_:

Click to download the PDB-style file with coordinates for d1fd0a_.
(The format of our PDB-style files is described here.)

Timeline for d1fd0a_: