Lineage for d1f76b_ (1f76 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1816697Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 1816698Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 1816743Protein Dihydroorotate dehydrogenase [51397] (8 species)
  7. 1816744Species Escherichia coli [TaxId:562] [82239] (1 PDB entry)
  8. 1816746Domain d1f76b_: 1f76 B: [76161]
    complexed with fmn, fmt, oro

Details for d1f76b_

PDB Entry: 1f76 (more details), 2.5 Å

PDB Description: escherichia coli dihydroorotate dehydrogenase
PDB Compounds: (B:) Dihydroorotate dehydrogenase (quinone)

SCOPe Domain Sequences for d1f76b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f76b_ c.1.4.1 (B:) Dihydroorotate dehydrogenase {Escherichia coli [TaxId: 562]}
myypfvrkalfqldperaheftfqqlrritgtpfealvrqkvpakpvncmgltfknplgl
aagldkdgecidalgamgfgsieigtvtprpqpgndkprlfrlvdaeglinrmgfnnlgv
dnlvenvkkahydgvlginigknkdtpveqgkddylicmekiyayagyiainisspntpg
lrtlqygealddlltaiknkqndlqamhhkyvpiavkiapdlseeeliqvadslvrhnid
gviatnttldrslvqgmkncdqtgglsgrplqlksteiirrlslelngrlpiigvggids
viaarekiaagaslvqiysgfifkgpplikeivthi

SCOPe Domain Coordinates for d1f76b_:

Click to download the PDB-style file with coordinates for d1f76b_.
(The format of our PDB-style files is described here.)

Timeline for d1f76b_: