Lineage for d1f76b_ (1f76 B:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 814735Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 814736Family c.1.4.1: FMN-linked oxidoreductases [51396] (18 proteins)
  6. 814782Protein Dihydroorotate dehydrogenase [51397] (7 species)
  7. 814783Species Escherichia coli [TaxId:562] [82239] (1 PDB entry)
  8. 814785Domain d1f76b_: 1f76 B: [76161]

Details for d1f76b_

PDB Entry: 1f76 (more details), 2.5 Å

PDB Description: escherichia coli dihydroorotate dehydrogenase
PDB Compounds: (B:) dihydroorotate dehydrogenase

SCOP Domain Sequences for d1f76b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f76b_ c.1.4.1 (B:) Dihydroorotate dehydrogenase {Escherichia coli [TaxId: 562]}
myypfvrkalfqldperaheftfqqlrritgtpfealvrqkvpakpvncmgltfknplgl
aagldkdgecidalgamgfgsieigtvtprpqpgndkprlfrlvdaeglinrmgfnnlgv
dnlvenvkkahydgvlginigknkdtpveqgkddylicmekiyayagyiainisspntpg
lrtlqygealddlltaiknkqndlqamhhkyvpiavkiapdlseeeliqvadslvrhnid
gviatnttldrslvqgmkncdqtgglsgrplqlksteiirrlslelngrlpiigvggids
viaarekiaagaslvqiysgfifkgpplikeivthi

SCOP Domain Coordinates for d1f76b_:

Click to download the PDB-style file with coordinates for d1f76b_.
(The format of our PDB-style files is described here.)

Timeline for d1f76b_: