Lineage for d1f6ll_ (1f6l L:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1511401Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1511486Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (19 PDB entries)
  8. 1511511Domain d1f6ll_: 1f6l L: [76159]
    VL of anti-ferritin antibody

Details for d1f6ll_

PDB Entry: 1f6l (more details), 2.8 Å

PDB Description: variable light chain dimer of anti-ferritin antibody
PDB Compounds: (L:) anti-ferritin immunoglobulin light chain

SCOPe Domain Sequences for d1f6ll_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f6ll_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
diqmtqspaslsasvgetvtitcraseniysylawyqqkqgkspqllvynaktlaegvps
rfsgsgsgtqfslkinslqpedfgsyycqhhygtpftfgsgtklei

SCOPe Domain Coordinates for d1f6ll_:

Click to download the PDB-style file with coordinates for d1f6ll_.
(The format of our PDB-style files is described here.)

Timeline for d1f6ll_: