Lineage for d1f18a_ (1f18 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1769113Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 1769114Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 1769127Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 1769134Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49336] (12 PDB entries)
  8. 1769147Domain d1f18a_: 1f18 A: [76150]
    complexed with cu, zn; mutant

Details for d1f18a_

PDB Entry: 1f18 (more details), 1.7 Å

PDB Description: crystal structure of yeast copper-zinc superoxide dismutase mutant gly85arg
PDB Compounds: (A:) copper-zinc superoxide dismutase

SCOPe Domain Sequences for d1f18a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f18a_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhihefgdatngcvsa
gphfnpfkkthgaptdevrhvgdmrnvktdengvakgsfkdslikligptsvvgrsvvih
agqddlgkgdteeslktgnagprpacgvigltn

SCOPe Domain Coordinates for d1f18a_:

Click to download the PDB-style file with coordinates for d1f18a_.
(The format of our PDB-style files is described here.)

Timeline for d1f18a_: