Lineage for d1duea_ (1due A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1793085Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 1793142Protein Epidermolytic (exfoliative) toxin A [50510] (1 species)
    probable glutamic acid-specific protease
  7. 1793143Species Staphylococcus aureus [TaxId:1280] [50511] (4 PDB entries)
  8. 1793147Domain d1duea_: 1due A: [76140]
    mutant

Details for d1duea_

PDB Entry: 1due (more details), 2 Å

PDB Description: crystal structure of exfoliative toxin a s195a mutant
PDB Compounds: (A:) exfoliative toxin a

SCOPe Domain Sequences for d1duea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1duea_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]}
evsaeeikkheekwnkyygvnafnlpkelfskvdekdrqkypyntignvfvkgqtsatgv
ligkntvltnrhiakfangdpskvsfrpsintddngntetpygeyevkeilqepfgagvd
lalirlkpdqngvslgdkispakigtsndlkdgdkleligypfdhkvnqmhrseielttl
srglryygftvpgnagsgifnsngelvgihsskvshldrehqinygvgignyvkriinek
ne

SCOPe Domain Coordinates for d1duea_:

Click to download the PDB-style file with coordinates for d1duea_.
(The format of our PDB-style files is described here.)

Timeline for d1duea_: