Lineage for d1dt2a_ (1dt2 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1545310Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1545311Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1545312Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 1545376Protein Exfoliative toxin B [50512] (1 species)
  7. 1545377Species Staphylococcus aureus [TaxId:1280] [50513] (2 PDB entries)
  8. 1545379Domain d1dt2a_: 1dt2 A: [76138]

Details for d1dt2a_

PDB Entry: 1dt2 (more details), 2.8 Å

PDB Description: crystal structure of exfoliative toxin b
PDB Compounds: (A:) exfoliative toxin b

SCOPe Domain Sequences for d1dt2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dt2a_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]}
eysaeeirklkqkfevpptdkelythitdnarspynsvgtvfvkgstlatgvligkntiv
tnyhvareaaknpsniiftpaqnrdaeknefptpygkfeaeeikespygqgldlaiiklk
pnekgesagdliqpanipdhidiqkgdkysllgypynysayslyqsqiemfndsqyfgyt
evgnsgsgifnlkgeligihsgkggqhnlpigvffnrkisslysvdntfgdtlgndlkkr
akldk

SCOPe Domain Coordinates for d1dt2a_:

Click to download the PDB-style file with coordinates for d1dt2a_.
(The format of our PDB-style files is described here.)

Timeline for d1dt2a_: