Lineage for d1d0ra_ (1d0r A:)

  1. Root: SCOPe 2.07
  2. 2596047Class j: Peptides [58231] (148 folds)
  3. 2596266Fold j.6: Peptide hormones [58283] (1 superfamily)
    contains one alpha-helix
  4. 2596267Superfamily j.6.1: Peptide hormones [58284] (1 family) (S)
    this is not a true superfamily
  5. 2596268Family j.6.1.1: Peptide hormones [58285] (19 proteins)
  6. 2596299Protein Glucagon-like peptide-1-(7-36)-amide [82969] (1 species)
  7. 2596300Species Human (Homo sapiens) [TaxId:9606] [82970] (1 PDB entry)
  8. 2596301Domain d1d0ra_: 1d0r A: [76137]

Details for d1d0ra_

PDB Entry: 1d0r (more details)

PDB Description: solution structure of glucagon-like peptide-1-(7-36)-amide in trifluoroethanol/water
PDB Compounds: (A:) glucagon-like peptide-1-(7-36)-amide

SCOPe Domain Sequences for d1d0ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d0ra_ j.6.1.1 (A:) Glucagon-like peptide-1-(7-36)-amide {Human (Homo sapiens) [TaxId: 9606]}
haegtftsdvssylegqaakefiawlvkgr

SCOPe Domain Coordinates for d1d0ra_:

Click to download the PDB-style file with coordinates for d1d0ra_.
(The format of our PDB-style files is described here.)

Timeline for d1d0ra_: