Lineage for d1co7e_ (1co7 E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795997Protein Trypsin(ogen) [50515] (9 species)
  7. 2796618Species Norway rat (Rattus norvegicus) [TaxId:10116] [50518] (37 PDB entries)
  8. 2796649Domain d1co7e_: 1co7 E: [76135]
    Other proteins in same PDB: d1co7i_
    complexed with ca; mutant

Details for d1co7e_

PDB Entry: 1co7 (more details), 1.9 Å

PDB Description: r117h mutant rat anionic trypsin complexed with bovine pancreatic trypsin inhibitor (bpti)
PDB Compounds: (E:) trypsin II

SCOPe Domain Sequences for d1co7e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1co7e_ b.47.1.2 (E:) Trypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnahvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

SCOPe Domain Coordinates for d1co7e_:

Click to download the PDB-style file with coordinates for d1co7e_.
(The format of our PDB-style files is described here.)

Timeline for d1co7e_: