SCOPe 2.07: Domain d9icua3: 9icu A:92-148

Lineage for d9icua3 (9icu A:92-148)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
   topological similarity to the N-terminal domain
   automatically mapped to Pfam PF10391

6. Protein DNA polymerase beta [81579] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [81575] (145 PDB entries)

8. Domain d9icua3: 9icu A:92-148 [76125]
   Other proteins in same PDB: d9icua1, d9icua4
   protein/DNA complex; complexed with mn, na, ttp

Details for d9icua3

PDB Entry: 9icu, 2.9 Å

PDB Description: dna polymerase beta (pol b) (e.c.2.7.7.7) complexed with six base pairs of dna; soaked in the presence of dttp (1 millimolar) and mncl2 (5 millimolar)

PDB Compounds: (A:) protein (DNA polymerase beta (e.c.2.7.7.7))

SCOPe Domain Sequences for d9icua3:

Sequence; same for both SEQRES and ATOM records:

>d9icua3 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek

Timeline for d9icua3:

• d9icua3 first appeared in SCOP 1.63
  
• d9icua3 appears in SCOPe 2.06
  
• d9icua3 appears in the current release, SCOPe 2.08