Lineage for d9icja3 (9icj A:92-148)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 770823Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 771412Superfamily a.60.12: PsbU/PolX domain-like [81585] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 771413Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
  6. 771414Protein DNA polymerase beta [81579] (2 species)
  7. 771415Species Human (Homo sapiens) [TaxId:9606] [81575] (107 PDB entries)
  8. 771473Domain d9icja3: 9icj A:92-148 [76103]
    Other proteins in same PDB: d9icja1, d9icja4
    protein/DNA complex; complexed with na, so4

Details for d9icja3

PDB Entry: 9icj (more details), 3.1 Å

PDB Description: dna polymerase beta (pol b) (e.c.2.7.7.7) complexed with seven base pairs of dna
PDB Compounds: (A:) protein (DNA polymerase beta (e.c.2.7.7.7))

SCOP Domain Sequences for d9icja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d9icja3 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek

SCOP Domain Coordinates for d9icja3:

Click to download the PDB-style file with coordinates for d9icja3.
(The format of our PDB-style files is described here.)

Timeline for d9icja3: