Lineage for d9icha3 (9ich A:92-148)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 444234Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 444633Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 444634Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
  6. 444635Protein DNA polymerase beta [81579] (2 species)
  7. 444636Species Human (Homo sapiens) [TaxId:9606] [81575] (92 PDB entries)
  8. 444680Domain d9icha3: 9ich A:92-148 [76099]
    Other proteins in same PDB: d9icha1, d9icha4

Details for d9icha3

PDB Entry: 9ich (more details), 2.9 Å

PDB Description: dna polymerase beta (pol b) (e.c.2.7.7.7) complexed with seven base pairs of dna; soaked in the presence of dgtp (1 millimolar) and zncl2 (1 millimolar)

SCOP Domain Sequences for d9icha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d9icha3 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens)}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek

SCOP Domain Coordinates for d9icha3:

Click to download the PDB-style file with coordinates for d9icha3.
(The format of our PDB-style files is described here.)

Timeline for d9icha3: