Lineage for d9icaa3 (9ica A:92-148)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 214550Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 214859Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 214860Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (2 proteins)
    topological similarity to the N-terminal domain
  6. 214861Protein DNA polymerase beta [81579] (2 species)
  7. 214862Species Human (Homo sapiens) [TaxId:9606] [81575] (92 PDB entries)
  8. 214911Domain d9icaa3: 9ica A:92-148 [76087]
    Other proteins in same PDB: d9icaa1, d9icaa4
    protein/DNA complex; complexed with mn, stp

Details for d9icaa3

PDB Entry: 9ica (more details), 3 Å

PDB Description: dna polymerase beta (e.c.2.7.7.7)/dna complex + 2'-deoxyadenosine-5'-o-(1-thiotriphosphate), soaked in the presence of datp(alpha)s and mncl2

SCOP Domain Sequences for d9icaa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d9icaa3 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens)}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek

SCOP Domain Coordinates for d9icaa3:

Click to download the PDB-style file with coordinates for d9icaa3.
(The format of our PDB-style files is described here.)

Timeline for d9icaa3: