SCOP 1.65: Domain d8icoa3: 8ico A:92-148

Lineage for d8icoa3 (8ico A:92-148)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.60: SAM domain-like [47768] (13 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (2 proteins)
   topological similarity to the N-terminal domain

6. Protein DNA polymerase beta [81579] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [81575] (92 PDB entries)

8. Domain d8icoa3: 8ico A:92-148 [76062]
   Other proteins in same PDB: d8icoa1, d8icoa4
   protein/DNA complex; complexed with azt, mn, na

Details for d8icoa3

PDB Entry: 8ico, 2.7 Å

PDB Description: dna polymerase beta (pol b) (e.c.2.7.7.7) complexed with seven base pairs of dna; soaked in the presence of azt-tp (1 millimolar) and mncl2 (5 millimolar)

SCOP Domain Sequences for d8icoa3:

Sequence; same for both SEQRES and ATOM records:

>d8icoa3 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens)}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek

Timeline for d8icoa3:

• d8icoa3 first appeared in SCOP 1.63
  
• d8icoa3 appears in SCOP 1.67
  
• d8icoa3 appears in the current release, SCOPe 2.08