| Class a: All alpha proteins [46456] (179 folds) |
| Fold a.60: SAM domain-like [47768] (13 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family) ![]() contains one classic and one pseudo HhH motifs |
| Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (2 proteins) topological similarity to the N-terminal domain |
| Protein DNA polymerase beta [81579] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [81575] (92 PDB entries) |
| Domain d8icga3: 8icg A:92-148 [76046] Other proteins in same PDB: d8icga1, d8icga4 protein/DNA complex; complexed with na |
PDB Entry: 8icg (more details), 3.3 Å
SCOP Domain Sequences for d8icga3:
Sequence; same for both SEQRES and ATOM records: (download)
>d8icga3 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens)}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek
Timeline for d8icga3: