SCOPe 2.05: Domain d7icta4: 7ict A:149-335

Lineage for d7icta4 (7ict A:149-335)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
   core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123

4. Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families)

5. Family d.218.1.2: DNA polymerase beta-like [81300] (5 proteins)
   insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain

6. Protein DNA polymerase beta, catalytic (31 kD) fragment [81578] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [81574] (144 PDB entries)
   Uniprot P06746

8. Domain d7icta4: 7ict A:149-335 [76031]
   Other proteins in same PDB: d7icta1, d7icta3
   protein/DNA complex; complexed with na, zn

Details for d7icta4

PDB Entry: 7ict, 2.8 Å

PDB Description: dna polymerase beta (e.c.2.7.7.7)/dna complex, soaked in the presence of zncl2 and mgcl2

PDB Compounds: (A:) protein (DNA polymerase beta (e.c.2.7.7.7))

SCOPe Domain Sequences for d7icta4:

Sequence; same for both SEQRES and ATOM records:

>d7icta4 d.218.1.2 (A:149-335) DNA polymerase beta, catalytic (31 kD) fragment {Human (Homo sapiens) [TaxId: 9606]}
ripreemlqmqdivlnevkkvdseyiatvcgsfrrgaessgdmdvllthpsftsestkqp
kllhqvveqlqkvhfitdtlskgetkfmgvcqlpskndekeyphrridirlipkdqyycg
vlyftgsdifnknmrahalekgftineytirplgvtgvageplpvdsekdifdyiqwkyr
epkdrse

Timeline for d7icta4:

• d7icta4 first appeared in SCOP 1.63
  
• d7icta4 appears in SCOPe 2.04
  
• d7icta4 appears in SCOPe 2.06
  
• d7icta4 appears in the current release, SCOPe 2.08