Lineage for d7icoa4 (7ico A:149-335)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563564Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 2563565Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 2563573Family d.218.1.2: DNA polymerase beta-like [81300] (5 protein domains)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 2563574Protein DNA polymerase beta, catalytic (31 kD) fragment [81578] (2 species)
  7. 2563575Species Human (Homo sapiens) [TaxId:9606] [81574] (145 PDB entries)
    Uniprot P06746
  8. 2563700Domain d7icoa4: 7ico A:149-335 [76021]
    Other proteins in same PDB: d7icoa1, d7icoa3
    protein/DNA complex; complexed with na, zn

Details for d7icoa4

PDB Entry: 7ico (more details), 3.3 Å

PDB Description: dna polymerase beta (e.c.2.7.7.7)/dna complex, soaked in the presence of zncl2
PDB Compounds: (A:) protein (DNA polymerase beta (e.c.2.7.7.7))

SCOPe Domain Sequences for d7icoa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d7icoa4 d.218.1.2 (A:149-335) DNA polymerase beta, catalytic (31 kD) fragment {Human (Homo sapiens) [TaxId: 9606]}
ripreemlqmqdivlnevkkvdseyiatvcgsfrrgaessgdmdvllthpsftsestkqp
kllhqvveqlqkvhfitdtlskgetkfmgvcqlpskndekeyphrridirlipkdqyycg
vlyftgsdifnknmrahalekgftineytirplgvtgvageplpvdsekdifdyiqwkyr
epkdrse

SCOPe Domain Coordinates for d7icoa4:

Click to download the PDB-style file with coordinates for d7icoa4.
(The format of our PDB-style files is described here.)

Timeline for d7icoa4: