Lineage for d2bpgb4 (2bpg B:149-335)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 265789Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 265790Superfamily d.218.1: Nucleotidyltransferase [81301] (4 families) (S)
  5. 265798Family d.218.1.2: DNA polymerase beta-like [81300] (3 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 265799Protein DNA polymerase beta, catalytic (31 kD) fragment [81578] (2 species)
  7. 265893Species Rat (Rattus norvegicus) [TaxId:10116] [81576] (17 PDB entries)
  8. 265912Domain d2bpgb4: 2bpg B:149-335 [75996]
    Other proteins in same PDB: d2bpga1, d2bpga3, d2bpgb1, d2bpgb3
    protein/DNA complex; complexed with dct, mg

Details for d2bpgb4

PDB Entry: 2bpg (more details), 3.6 Å

PDB Description: structures of ternary complexes of rat dna polymerase beta, a dna template-primer, and ddctp

SCOP Domain Sequences for d2bpgb4:

Sequence, based on SEQRES records: (download)

>d2bpgb4 d.218.1.2 (B:149-335) DNA polymerase beta, catalytic (31 kD) fragment {Rat (Rattus norvegicus)}
ripreemlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftsesskqp
kllhrvveqlqkvrfitdtlskgetkfmgvcqlpsendeneyphrridirlipkdqyycg
vlyftgsdifnknmrahalekgftineytirplgvtgvageplpvdseqdifdyiqwryr
epkdrse

Sequence, based on observed residues (ATOM records): (download)

>d2bpgb4 d.218.1.2 (B:149-335) DNA polymerase beta, catalytic (31 kD) fragment {Rat (Rattus norvegicus)}
ripreemlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftsesskqp
kllhrvveqlqkvrfitdtlskgetkfmgvcqlpseneyphrridirlipkdqyycgvly
ftgsdifnknmrahalekgftineytirplgvtgvageplpvdseqdifdyiqwryrepk
drse

SCOP Domain Coordinates for d2bpgb4:

Click to download the PDB-style file with coordinates for d2bpgb4.
(The format of our PDB-style files is described here.)

Timeline for d2bpgb4: