Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically |
Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins) a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species) also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits |
Species Chicken (Gallus gallus) [TaxId:9031] [81639] (8 PDB entries) |
Domain d2bccc3: 2bcc C:2-261 [75988] Other proteins in same PDB: d2bcca1, d2bcca2, d2bccb1, d2bccb2, d2bccc2, d2bccd2, d2bccd3, d2bcce1, d2bcce2, d2bccf_, d2bccg_, d2bcch_, d2bccj_ complexed with bog, fes, hem, pee, sig, u10 |
PDB Entry: 2bcc (more details), 3.5 Å
SCOPe Domain Sequences for d2bccc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bccc3 f.21.1.2 (C:2-261) Mitochondrial cytochrome b subunit, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} apnirkshpllkminnslidlpapsnisawwnfgsllavclmtqiltglllamhytadts lafssvahtcrnvqygwlirnlhangasffficiflhigrglyygsylyketwntgvill ltlmatafvgyvlpwgqmsfwgatvitnlfsaipyightlvewawggfsvdnptltrffa lhfllpfaiagitiihltflhesgsnnplgissdsdkipfhpyysfkdilgltlmltpfl tlalfspnllgdpenftpan
Timeline for d2bccc3: