Lineage for d1zqya2 (1zqy A:149-335)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 740075Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 740076Superfamily d.218.1: Nucleotidyltransferase [81301] (11 families) (S)
  5. 740084Family d.218.1.2: DNA polymerase beta-like [81300] (4 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 740085Protein DNA polymerase beta, catalytic (31 kD) fragment [81578] (2 species)
  7. 740190Species Rat (Rattus norvegicus) [TaxId:10116] [81576] (17 PDB entries)
  8. 740194Domain d1zqya2: 1zqy A:149-335 [75984]
    Other proteins in same PDB: d1zqya1

Details for d1zqya2

PDB Entry: 1zqy (more details), 2.3 Å

PDB Description: dna polymerase beta (pol b) (e.c.2.7.7.7), 31-kd domain; soaked in the presence of mgcl2 (50 millimolar)
PDB Compounds: (A:) DNA polymerase beta

SCOP Domain Sequences for d1zqya2:

Sequence, based on SEQRES records: (download)

>d1zqya2 d.218.1.2 (A:149-335) DNA polymerase beta, catalytic (31 kD) fragment {Rat (Rattus norvegicus) [TaxId: 10116]}
ripreemlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftsesskqp
kllhrvveqlqkvrfitdtlskgetkfmgvcqlpsendeneyphrridirlipkdqyycg
vlyftgsdifnknmrahalekgftineytirplgvtgvageplpvdseqdifdyiqwryr
epkdrse

Sequence, based on observed residues (ATOM records): (download)

>d1zqya2 d.218.1.2 (A:149-335) DNA polymerase beta, catalytic (31 kD) fragment {Rat (Rattus norvegicus) [TaxId: 10116]}
ripreemlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftsesskqp
kllhrvveqlqkvrfitdtlskgetkfmgvcqlpseneyphrridirlipkdqyycgvly
ftgsdifnknmrahalekgftineytirplgvtgvageplpvdseqdifdyiqwryrepk
drse

SCOP Domain Coordinates for d1zqya2:

Click to download the PDB-style file with coordinates for d1zqya2.
(The format of our PDB-style files is described here.)

Timeline for d1zqya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zqya1