Lineage for d1zqva1 (1zqv A:91-148)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1737577Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1738431Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1738432Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
    automatically mapped to Pfam PF10391
  6. 1738433Protein DNA polymerase beta [81579] (2 species)
  7. 1738579Species Norway rat (Rattus norvegicus) [TaxId:10116] [81577] (23 PDB entries)
  8. 1738600Domain d1zqva1: 1zqv A:91-148 [75977]
    Other proteins in same PDB: d1zqva2
    complexed with ca

Details for d1zqva1

PDB Entry: 1zqv (more details), 2.7 Å

PDB Description: dna polymerase beta (pol b) (e.c.2.7.7.7), 31-kd domain; soaked in the presence of cacl2 (150 millimolar)
PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d1zqva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zqva1 a.60.12.1 (A:91-148) DNA polymerase beta {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ddtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfek

SCOPe Domain Coordinates for d1zqva1:

Click to download the PDB-style file with coordinates for d1zqva1.
(The format of our PDB-style files is described here.)

Timeline for d1zqva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zqva2