Class a: All alpha proteins [46456] (171 folds) |
Fold a.60: SAM domain-like [47768] (13 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family) contains one classic and one pseudo HhH motifs |
Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (2 proteins) topological similarity to the N-terminal domain |
Protein DNA polymerase beta [81579] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [81575] (92 PDB entries) |
Domain d1zqca3: 1zqc A:92-148 [75939] Other proteins in same PDB: d1zqca1, d1zqca4 protein/DNA complex; complexed with ca |
PDB Entry: 1zqc (more details), 3.2 Å
SCOP Domain Sequences for d1zqca3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zqca3 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens)} dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek
Timeline for d1zqca3: