SCOP 1.69: Domain d1qcrc2: 1qcr C:261-379

Lineage for d1qcrc2 (1qcr C:261-379)

Root: SCOP 1.69
Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
core: three transmembrane helices, up-and-down bundle
Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (1 family)

Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (2 proteins)
a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)
Species Cow (Bos taurus) [TaxId:9913] [81643] (12 PDB entries)
Domain d1qcrc2: 1qcr C:261-379 [75931]
Other proteins in same PDB: d1qcra1, d1qcra2, d1qcrb1, d1qcrb2, d1qcrc3, d1qcrd2, d1qcrd3, d1qcre1, d1qcre2, d1qcrf_, d1qcrg_, d1qcrh_, d1qcrj_, d1qcrk_

Details for d1qcrc2

PDB Entry: 1qcr (more details), 2.7 Å

PDB Description: crystal structure of bovine mitochondrial cytochrome bc1 complex, alpha carbon atoms only

SCOP Domain Sequences for d1qcrc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcrc2 f.32.1.1 (C:261-379) Mitochondrial cytochrome b subunit, C-terminal domain {Cow (Bos taurus)}
plntpphikpewyflfayailrsipnklggvlalafsililalipllhtskqrsmmfrpl
sqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmptagtienkllkw

SCOP Domain Coordinates for d1qcrc2:

Click to download the PDB-style file with coordinates for d1qcrc2.
(The format of our PDB-style files is described here.)

Timeline for d1qcrc2: