SCOPe 2.08: Domain d1l5ac1: 1l5a C:1-174

Lineage for d1l5ac1 (1l5a C:1-174)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
   core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest

4. Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families)

5. Family c.43.1.2: NRPS condensation domain (amide synthase) [75229] (2 proteins)
   Pfam PF00668; functional domain of multifunctional enzyme containing tandem repeat of two CAT subunit-like domains

6. Protein VibH [75230] (1 species)
   relative spatial position of the domains is similar to the monomers in CAT trimer

7. Species Vibrio cholerae [TaxId:666] [75231] (1 PDB entry)

8. Domain d1l5ac1: 1l5a C:1-174 [75927]

Details for d1l5ac1

PDB Entry: 1l5a, 2.55 Å

PDB Description: Crystal Structure of VibH, an NRPS Condensation Enzyme

PDB Compounds: (C:) amide synthase

SCOPe Domain Sequences for d1l5ac1:

Sequence; same for both SEQRES and ATOM records:

>d1l5ac1 c.43.1.2 (C:1-174) VibH {Vibrio cholerae [TaxId: 666]}
mllaqkpfwqrhlayphinldtvahslrltgpldttlllralhltvseidlfrarfsaqg
elywhpfsppidyqdlsihleaeplawrqieqdlqrsstlidapitshqvyrlshsehli
ytrahhivldgygmmlfeqrlsqhyqsllsgqtptaafkpyqsyleeeaaylts

Timeline for d1l5ac1:

• d1l5ac1 first appeared in SCOP 1.63
  
• d1l5ac1 appears in SCOPe 2.07