![]() | Class g: Small proteins [56992] (85 folds) |
![]() | Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
![]() | Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families) ![]() |
![]() | Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins) |
![]() | Protein DNA repair protein MutM (Fpg) [81622] (4 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [81613] (9 PDB entries) |
![]() | Domain d1l2da3: 1l2d A:235-274 [75922] Other proteins in same PDB: d1l2da1, d1l2da2 DNA estranged guanine mismatch recognition complex complexed with hpd, zn |
PDB Entry: 1l2d (more details), 2 Å
SCOP Domain Sequences for d1l2da3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l2da3 g.39.1.8 (A:235-274) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]} fqhhlyvygrqgnpckrcgtpiektvvagrgthycprcqr
Timeline for d1l2da3: