SCOPe 2.05: Domain d1l2da2: 1l2d A:2-134

Lineage for d1l2da2 (1l2d A:2-134)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
   pseudobarrel; capped on both ends by alpha-helices

4. Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family)
   automatically mapped to Pfam PF01149

5. Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (4 proteins)

6. Protein DNA repair protein MutM (Fpg) [81621] (4 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [81612] (23 PDB entries)

8. Domain d1l2da2: 1l2d A:2-134 [75921]
   Other proteins in same PDB: d1l2da1, d1l2da3
   DNA estranged guanine mismatch recognition complex
   protein/DNA complex; complexed with zn

Details for d1l2da2

PDB Entry: 1l2d, 2 Å

PDB Description: MutM (Fpg)-DNA Estranged Guanine Mismatch Recognition Complex

PDB Compounds: (A:) MutM

SCOPe Domain Sequences for d1l2da2:

Sequence; same for both SEQRES and ATOM records:

>d1l2da2 b.113.1.1 (A:2-134) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]}
pelpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgkf
lkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkfgtmhvya
keeadrrpplael

Timeline for d1l2da2:

• d1l2da2 first appeared in SCOP 1.63
  
• d1l2da2 appears in SCOPe 2.04
  
• d1l2da2 appears in SCOPe 2.06
  
• d1l2da2 appears in the current release, SCOPe 2.08